PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10022975m
Common NameCARUB_v10022975mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GRF
Protein Properties Length: 532aa    MW: 56679.5 Da    PI: 9.4207
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10022975mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.7e-25202246145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Carubv10022975m 202 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEG 246
                      79****************************************985 PP

2QLQ51.53.1e-18138174137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++F+ +Q+++L++Q+l+yKy+ an+PvP+ Ll+ ++k
  Carubv10022975m 138 GPFSLTQWAELEQQALIYKYITANVPVPSSLLLSLKK 174
                      59******************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-10138174IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.723139174IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-12139171IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.954202246IPR014977WRC domain
PfamPF088793.4E-21203245IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MDLGVRVPCN ENNGSSPGQT ELGSGFSNKQ ERSGFDGEED CWRSSKLSRT SNDGFSSSSA  60
AAAKTLSFHQ GIPLLRSTTI DPRRGGGQEH MLSFSSPSDK SDVSPYLQYC RNSGYGGLGG  120
GMMNTSSMHG NLLTGVKGPF SLTQWAELEQ QALIYKYITA NVPVPSSLLL SLKKSFFPYG  180
SLPPNSYGWG SFHLGFSGGN MDPEPGRCRR TDGKKWRCSR DAVPDQKYCE RHINRGRHRS  240
RKPVEGQNGH NTTAAAASTA AAVSKAAGTS AVAMRGSDHN NSLAAAARTH RHANNQSTDS  300
LATRVQNSRG ASVFPATMNL QTKDPHPKQS NNPFEFGIIS SDALLNPSHK QASYGNSSKG  360
FGSYLDFSNQ AKHSGNHHND DSWPPEELKS DWTQLSMSIP MAPSSPVQDK VALSPLRLSR  420
EFDPAIHMGL GVNTEFLEPG KKANNWIPIS WGNNNSMGGP LGEVLNSTTN SPKFGSSPTG  480
VLQKSTFGSL SNSSSGSSTI IGDNSNKNGS DGKDPLGPTT LMNTSATVPS L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935600.0AB493560.1 Arabidopsis thaliana At2g22840 mRNA for hypothetical protein, partial cds, clone: RAAt2g22840.
GenBankAY1026340.0AY102634.1 Arabidopsis thaliana transcription activator (GRF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293984.10.0hypothetical protein CARUB_v10022975mg
SwissprotO810010.0GRF1_ARATH; Growth-regulating factor 1
TrEMBLR0FVC10.0R0FVC1_9BRAS; Uncharacterized protein
STRINGAT2G22840.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.10.0growth-regulating factor 1